PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 307aa    MW: 33064.9 Da    PI: 8.9366
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020250.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.12e-08654347
                     SS-HHHHHHHHHHHHHTTTT.....-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg.....tWktIartmgkgRtlkqcksrwqky 47
                      W +eEd+ + +a++++  +      W++Ia+ ++  ++  ++k ++q++
      Pbr020250.1  6 VWNKEEDKEFENAIAMHWIDenskeMWEKIAELVP-SKSMGELKQHYQML 54
                     6*****************99***************.************86 PP

2Myb_DNA-binding38.92e-12137181347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
      Pbr020250.1 137 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 181
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.969259IPR017884SANT domain
SMARTSM007174.7E-5357IPR001005SANT/Myb domain
SuperFamilySSF466896.42E-9560IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-4655IPR009057Homeodomain-like
PfamPF002494.7E-6654IPR001005SANT/Myb domain
CDDcd001673.29E-8755No hitNo description
PROSITE profilePS5129417.441129186IPR017930Myb domain
SuperFamilySSF466893.73E-17132187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-17133184IPR006447Myb domain, plants
SMARTSM007172.3E-10134184IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-11135180IPR009057Homeodomain-like
PfamPF002497.6E-11137181IPR001005SANT/Myb domain
CDDcd001671.06E-9137182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSSSSVWNKE EDKEFENAIA MHWIDENSKE MWEKIAELVP SKSMGELKQH YQMLVDDVGA  60
IEAGRVSPPN YAADEAANTL SSSKDSGHRA SSSGASASEK RLNCGHGGGF SGLGHDSAGH  120
GGKGGSRADQ ERKKGIPWTE EEHRLFLLGL DKFGKGDWRS ISRNFVISRT PTQVASHAQK  180
YFIRLNSMNR DRRRSSIHDI TSVNNGDVSS HQQPPITGQQ TNTYAPSAGT AIRVGGPQTA  240
KHRPQPHMAG LGMYGAPMGH PVSAPPGHMA SAVGTPVMLP PGHHPHAHPP YVVPVAYPMA  300
HPTMHQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2507970.0AB250797.1 Pyrus pyrifolia DNA, microsatellite locus IPPN018.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009346842.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-61DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLD9ZJ770.0D9ZJ77_MALDO; MYBR domain class transcription factor
STRINGPOPTR_0012s05720.11e-142(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106943340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.18e-76MYB family protein